Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405418 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Steroid Sulfatase (Microsomal), Isozyme S (STS) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-STS antibody: synthetic peptide directed towards the middle region of human STS
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Bovine, Canine, Porcine
- Host
- Rabbit
- Antigen sequence
EPTSNMDIFPTVAKLAGAPLPEDRIIDGRDLMPLL
EGKSQ RSDHEFLFHY- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Steroid sulfatase and sulfuryl transferase activities in human brain tumors.
Kríz L, Bicíková M, Mohapl M, Hill M, Cerný I, Hampl R
The Journal of steroid biochemistry and molecular biology 2008 Mar;109(1-2):31-9
The Journal of steroid biochemistry and molecular biology 2008 Mar;109(1-2):31-9
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting