Explore
Validate
Learn
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Immunohistochemistry [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA002904 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA002904, RRID:AB_1080116
- Product name
- Anti-STS
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
YEIIQQPMSYDNLTQRLTVEAAQFIQRNTETPFLL
VLSYLHVHTALFSSKDFAGKSQHGVYGDAVEEMDW
SVGQILNLLDELRLANDTLIYFTSDQGAHVEEVSS
KGEIHGGSNGIY- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Local estrogen metabolism in epithelial ovarian cancer suggests novel targets for therapy.
Isolation of primitive endoderm, mesoderm, vascular endothelial and trophoblast progenitors from human pluripotent stem cells
Inhibition of steroid sulfatase decreases endometriosis in an in vivo murine model
Ren X, Wu X, Hillier SG, Fegan KS, Critchley HO, Mason JI, Sarvi S, Harlow CR
The Journal of steroid biochemistry and molecular biology 2015 Jun;150:54-63
The Journal of steroid biochemistry and molecular biology 2015 Jun;150:54-63
Isolation of primitive endoderm, mesoderm, vascular endothelial and trophoblast progenitors from human pluripotent stem cells
Drukker M, Tang C, Ardehali R, Rinkevich Y, Seita J, Lee A, Mosley A, Weissman I, Soen Y
Nature Biotechnology 2012 May;30(6):531-542
Nature Biotechnology 2012 May;30(6):531-542
Inhibition of steroid sulfatase decreases endometriosis in an in vivo murine model
Colette S, Defrere S, Lousse J, Van Langendonckt A, Gotteland J, Loumaye E, Donnez J
Human Reproduction 2011 May;26(6):1362-1370
Human Reproduction 2011 May;26(6):1362-1370
No comments: Submit comment
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human placenta and pancreas tissues using Anti-STS antibody. Corresponding STS RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows low expression as expected.
- Sample type
- HUMAN
