Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184175 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Cullin 1 (CUL1) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CUL1 antibody: synthetic peptide directed towards the C terminal of human CUL1
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
HQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEY
LERVD GEKDTYSYLA- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references CUL1, a component of E3 ubiquitin ligase, alters lymphocyte signal transduction with possible effect on rheumatoid arthritis.
Kawaida R, Yamada R, Kobayashi K, Tokuhiro S, Suzuki A, Kochi Y, Chang X, Sekine A, Tsunoda T, Sawada T, Furukawa H, Nakamura Y, Yamamoto K
Genes and immunity 2005 May;6(3):194-202
Genes and immunity 2005 May;6(3):194-202
No comments: Submit comment
No validations: Submit validation data