Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN504593 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Cullin 2 (CUL2) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CUL2 antibody: synthetic peptide directed towards the middle region of human CUL2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus
- Host
- Rabbit
- Antigen sequence
HNALIQEVISQSRARFNPSISMIKKCIEVLIDKQY
IERSQ ASADEYSYVA- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Human papillomavirus type 16 E7 oncoprotein associates with the cullin 2 ubiquitin ligase complex, which contributes to degradation of the retinoblastoma tumor suppressor.
Huh K, Zhou X, Hayakawa H, Cho JY, Libermann TA, Jin J, Harper JW, Munger K
Journal of virology 2007 Sep;81(18):9737-47
Journal of virology 2007 Sep;81(18):9737-47
No comments: Submit comment
No validations: Submit validation data