Antibody data

Product number
H00006620-M16
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006620-M16, RRID:AB_1204992
Product name
SNCB monoclonal antibody (M16), clone 4F11
Provider product page
Abnova Corporation - H00006620-M16
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SNCB.
Antigen sequence
MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKE
GVLYVGSKTREGVVQGVASVAEKTKEQASH
Isotype
IgG
Antibody clone number
4F11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -