HPA018840

FHIT antibody from Sigma-Aldrich
AP3Aase, FRA3B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018840
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018840, RRID:AB_1848538
Product name
Anti-FHIT antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018840
Antibody type
Polyclonal
Antigen
Bis(5'-adenosyl)-triphosphatase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVL
VCPLRPVERFHDLRPDEVADLFQTTQRVGTVVE
Storage
-20C
Provider Type Product Number
- No reagents -