Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA068768 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA068768, RRID:AB_2686029
- Product name
- Anti-APOE
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
QAKVEQAVETEPEPELRQQTEWQSGQRWELALGRF
WDYLRWVQTL- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Plasma proteins elevated in severe asthma despite oral steroid use and unrelated to Type-2 inflammation
Sparreman Mikus M, Kolmert J, Andersson L, Östling J, Knowles R, Gómez C, Ericsson M, Thörngren J, Emami Khoonsari P, Dahlén B, Kupczyk M, De Meulder B, Auffray C, Bakke P, Beghe B, Bel E, Caruso M, Chanez P, Chawes B, Fowler S, Gaga M, Geiser T, Gjomarkaj M, Horváth I, Howarth P, Johnston S, Joos G, Krug N, Montuschi P, Musial J, Niżankowska-Mogilnicka E, Olsson H, Papi A, Rabe K, Sandström T, Shaw D, Siafakas N, Uhlén M, Riley J, Bates S, Middelveld R, Wheelock C, Chung K, Adcock I, Sterk P, Djukanovic R, Nilsson P, Dahlén S, James A
European Respiratory Journal 2022;59(2):2100142
European Respiratory Journal 2022;59(2):2100142
No comments: Submit comment
No validations: Submit validation data