Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503507 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Apolipoprotein E (APOE) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-APOE antibody: synthetic peptide directed towards the N terminal of human APOE
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
KVLWAALLVTFLAGCQAKVEQAVETEPEPELRQQT
EWQSG QRWELALGRF- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Identification of an amino-terminal fragment of apolipoprotein E4 that localizes to neurofibrillary tangles of the Alzheimer's disease brain.
Metabolic syndrome and cognitive decline in chinese older adults: results from the singapore longitudinal ageing studies.
Rohn TT, Catlin LW, Coonse KG, Habig JW
Brain research 2012 Sep 26;1475:106-15
Brain research 2012 Sep 26;1475:106-15
Metabolic syndrome and cognitive decline in chinese older adults: results from the singapore longitudinal ageing studies.
Ho RC, Niti M, Yap KB, Kua EH, Ng TP
The American journal of geriatric psychiatry : official journal of the American Association for Geriatric Psychiatry 2008 Jun;16(6):519-22
The American journal of geriatric psychiatry : official journal of the American Association for Geriatric Psychiatry 2008 Jun;16(6):519-22
No comments: Submit comment
No validations: Submit validation data