Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB29439 - Provider product page

- Provider
- Abnova Corporation
- Product name
- DBN1 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant human DBN1.
- Antigen sequence
PSPILDSEETRAAAPQAWAGPMEEPPQAQAPPRGP
GSPAEDLMFMESAEQAVLAAPVEPATADATEIHDA
ADTIETDTATADTTVANNVPPAATSLIDLWP- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescent staining of human cell line U-2 OS with DBN1 polyclonal antibody (Cat # PAB29439) at 1-4 ug/mL concentration shows positivity in plasma membrane and actin filaments.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human kidney with DBN1 polyclonal antibody (Cat # PAB29439) shows strong membranous positivity in distal tubules at 1:500-1:1000 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)