Antibody data

Product number
H00004680-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004680-M02, RRID:AB_10549725
Product name
CEACAM6 monoclonal antibody (M02), clone 1G2
Provider product page
Abnova Corporation - H00004680-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant CEACAM6.
Antigen sequence
PVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPR
LQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANR
SDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCH
AASNP
Isotype
IgG
Antibody clone number
1G2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -