AV41504

CEACAM6 antibody from Sigma-Aldrich
CD66c, NCA
Immunohistochemistry
Recommended by provider

Antibody data

Product number
AV41504
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV41504, RRID:AB_1846324
Product name
Anti-CEACAM6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV41504
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human CEACAM6 with an internal ID of S09602
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
EIQNPASANRSDPVTLNVLYGPDGPTISPSKANYR
PGENLNLSCHAASNP
Storage
-20C
Provider Type Product Number
- No reagents -