AMAb90591

RUNX2 antibody from Atlas Antibodies
AML3, CBFA1, CCD, CCD1, PEBP2A1, PEBP2aA1
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
AMAb90591
Provider
Atlas Antibodies
Product name
Anti-RUNX2
Provider product page
Atlas Antibodies - AMAb90591
Antibody type
Monoclonal
Description
Protein A purified
Reactivity
Human
Host
Mouse
Conjugate
Unconjugated
Antigen sequence
LNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYP
SYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRI
SGASELGPFSDPRQFPSISSLTESRFSNPRMHYPA
Epitope
Binds to an epitope located within the peptide sequence VPRRISGASELGPFS as determined by overlapping synthetic peptides.
Isotype
IgG
Antibody clone number
CL0232
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -