Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002720-M01 - Provider product page 
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002720-M01, RRID:AB_490084
- Product name
- GLB1 monoclonal antibody (M01), clone 6E7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant GLB1.
- Antigen sequence
- KGQVWINGFNLGRYWPARGPQLTLFVPQHILMTSA
 PNTITVLELEWAPCSSDDPELCAVTFVDRPVIGSS
 VTYDHPSKPVEKRLMPPPPQKNKDSWLDHV
- Isotype
- IgG
- Antibody clone number
- 6E7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
				- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- GLB1 monoclonal antibody (M01), clone 6E7 Western Blot analysis of GLB1 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- Western Blot analysis of GLB1 expression in transfected 293T cell line by GLB1 monoclonal antibody (M01), clone 6E7.Lane 1: GLB1 transfected lysate(76.1 KDa).Lane 2: Non-transfected lysate.
							
					Supportive validation
					
									
				
				- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- Detection limit for recombinant GST tagged GLB1 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
							
					Supportive validation
					
									
				
		- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- Immunoprecipitation of GLB1 transfected lysate using anti-GLB1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with GLB1 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol