Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00091851-M02 - Provider product page

- Provider
- Abnova Corporation
- Product name
- CHRDL1 monoclonal antibody (M02), clone 1D10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CHRDL1.
- Antigen sequence
MPVYESVFMEDGETTRKIALETERPPQVEVHVWTI
RKGILQHFHIEKISKRMFEELPHFKLVTRTTLSQW
KIFTEGEAQISQMCSSRVCRTELEDLVKVLYLERS
EKGHC- Isotype
- IgG
- Antibody clone number
- 1D10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CHRDL1 monoclonal antibody (M02), clone 1D10. Western Blot analysis of CHRDL1 expression in Hela S3 NE.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CHRDL1 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol