HPA020086

SLC1A1 antibody from Atlas Antibodies
EAAC1, EAAT3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020086
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020086, RRID:AB_1849766
Product name
Anti-SLC1A1
Provider product page
Atlas Antibodies - HPA020086
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NMFPENLVQACFQQYKTKREEVKPPSDPEMNMTEE
SFTAVMTTAISKNKTKEY
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -