Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502443 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Solute Carrier Family 1 (Neuronal/epithelial High Affinity Glutamate Transporter, System Xag), Member 1 (SLC1A1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SLC1A1 antibody: synthetic peptide directed towards the N terminal of human SLC1A1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine, Rabbit, Xenopus
- Host
- Rabbit
- Antigen sequence
VLVREHSNLSTLEKFYFAFPGEILMRMLKLIILPL
IISSM ITGVAALDSN- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The endoplasmic reticulum exit of glutamate transporter is regulated by the inducible mammalian Yip6b/GTRAP3-18 protein.
Ruggiero AM, Liu Y, Vidensky S, Maier S, Jung E, Farhan H, Robinson MB, Sitte HH, Rothstein JD
The Journal of biological chemistry 2008 Mar 7;283(10):6175-83
The Journal of biological chemistry 2008 Mar 7;283(10):6175-83
No comments: Submit comment
No validations: Submit validation data