HPA020086

SLC1A1 antibody from Sigma-Aldrich
EAAC1, EAAT3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020086
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020086, RRID:AB_1849766
Product name
Anti-SLC1A1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020086
Antibody type
Polyclonal
Antigen
Excitatory amino acid transporter 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NMFPENLVQACFQQYKTKREEVKPPSDPEMNMTEE
SFTAVMTTAISKNKTKEY
Storage
-20C
Provider Type Product Number
- No reagents -