Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- 298226 - Provider product page
- Provider
- United States Biological
- Product name
- Parathyroid Hormone Related Peptide (PTHLH, PTHRP, Parathyroid Hormone-Like Protein, PLP)
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide corresponding to aa53-86, KNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTP, of human PTHrP, KLH conjugated.
- Description
- Purified by Protein G affinity chromatography.
- Host
- Goat
- Isotype
- IgG
- Vial size
- Blue Ice
- Concentration
- Not determined
- Storage
- -20°C
No comments: Submit comment
No validations: Submit validation data