Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005744-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005744-M01, RRID:AB_425638
- Product name
- PTHLH monoclonal antibody (M01), clone 3H1-5G8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant PTHLH.
- Antigen sequence
MQRRLVQQWSVAVFLLSYAVPSCGRSVEGLSRRLK
RAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTA
EIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLT
QETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKK
RRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSR- Isotype
- IgG
- Antibody clone number
- 3H1-5G8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The expression of PTHLH in human gastric mucosa enterochromaffin-like cells.
Liu C, Chen J, Guo Y, Yang L, Zhao C, Bai L
Digestive diseases and sciences 2011 Apr;56(4):993-8
Digestive diseases and sciences 2011 Apr;56(4):993-8
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PTHLH is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to PTHLH on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to PTHLH on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol