HPA019467

TAGLN antibody from Atlas Antibodies
DKFZp686P11128, SM22, SMCC, TAGLN1, WS3-10
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019467
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019467, RRID:AB_1857245
Product name
Anti-TAGLN
Provider product page
Atlas Antibodies - HPA019467
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQ
VWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVF
KQMEQV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -