Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB29569 - Provider product page

- Provider
- Abnova Corporation
- Product name
- LY75 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant human LY75.
- Antigen sequence
LRWTAYEKINKWTDNRELTYSNFHPLLVSGRLRIP
ENFFEEESRYHCALILNLQKSPFTGTWNFTSCSER
HFVSLCQKYSEVKSRQTLQNASETVKYLNN- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot (Cell lysate) analysis of Lane 1: RT-4 cell lysate, Lane 2: U-251MG cell lysate, Lane 3: Human plasma (IgG/HSA depleted) with LY75 polyclonal antibody (Cat # PAB29569).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human colon with LY75 polyclonal antibody (Cat # PAB29569) shows moderate cytoplasmic positivity in glandular cells at 1:200 - 1:500 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)