HPA000254

F9 antibody from Sigma-Aldrich
FIX
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000254
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000254, RRID:AB_1078785
Product name
Anti-F9 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000254
Antibody type
Polyclonal
Antigen
Coagulation factor IX precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SKLTRAETVFPDVDYVNSTEAETILDNITQSTQSF
NDFTRVVGGEDAKPGQFPWQVVLNGKVDAFCGGSI
VNEKWIVTAAHCVETGVKITVVAGEHNIEE
Storage
-20C
Provider Type Product Number
- No reagents -