HPA023099

antibody from Atlas Antibodies

Targeting: CALB1 CALB

Antibody data

Submit

Validation data

Product number: HPA023099 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA023099, RRID:AB_1845859
Product name: Anti-CALB1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: QSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQ ELQQARKKAGLELSPEMKTFVDQYGQRDDGKIGIV ELAHVLPTEENFLLLFRCQQ
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CALB1 protein structure - HPA023099 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human kidney and lymph node tissues using Anti-CALB1 antibody. Corresponding CALB1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebellum, kidney, liver and lymph node using Anti-CALB1 antibody HPA023099 (A) shows similar protein distribution across tissues to independent antibody HPA056734 (B).
Antibody #2 product nr: HPA056734
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebellum shows strong cytoplasmic and nuclear positivity in Purkinje cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebellum using Anti-CALB1 antibody HPA023099.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-CALB1 antibody HPA023099.
Sample type: HUMAN