Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB22308 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB22308, RRID:AB_10967243
- Product name
- C9 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant C9.
- Antigen sequence
CLGYHLDVSLAFSEISVGAEFNKDDCVKRGEGRAV
NITSENLIDDVVSLIRGGTRKYAFELKEKLLRGTV
IDVTDFVNWASSINDAPVLISQKLSPIYNLVPVKM
KNAHLKKQNLERAIEDYINEFSVRKCHTCQNGGTV
ILMDGK- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Submitted references Monoclonal antibody targeting complement C9 binding domain of Trichinella spiralis paramyosin impairs the viability of Trichinella infective larvae in the presence of complement.
Hao Y, Zhao X, Yang J, Gu Y, Sun R, Zhu X
Parasites & vectors 2014 Jul 4;7:313
Parasites & vectors 2014 Jul 4;7:313
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescent staining of human cell line U-251 MG shows positivity in plasma membrane & cytoplasm.Using C9 polyclonal antibody (Cat # PAB22308).
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human ovary with C9 polyclonal antibody (Cat # PAB22308) shows strong cytoplasmic positivity in follicle cells at 1:10-1:20 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)