H00001280-M06

COL2A1 antibody from Abnova Corporation
AOM, SEDC, STL1
No application information provided.

Antibody data

Product number
H00001280-M06
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001280-M06, RRID:AB_1574060
Product name
COL2A1 monoclonal antibody (M06), clone 1E1
Provider product page
Abnova Corporation - H00001280-M06
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant COL2A1.
Antigen sequence
MSAFAGLGPREKGPDPLQYMRADQAAGGLRQHDAE
VDATLKSLNNQIESIRSPEGSRKNPARTCRDLKLC
HPEWKSGDYWIDPNQGCTLDAMKVFCNMETGETCV
YPNPANVPKKNWWSSKSKEKKHIWFGETINGGFHF
SYGDDNLAPNTANVQMTFLRLLSTEGSQNITYHCK
NSIAYLDEAAGNLKKALLIQGSNDVEIRAEGNSRF
TYTALKDGCTKHTGKWGKTVIEYRSQKTSRLPIID
IAPMDIGGPEQEFGVDIGPVCFL
Isotype
IgG
Antibody clone number
1E1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -