Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182373 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Caudal Type Homeobox 2 (CDX2) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CDX2 antibody: synthetic peptide directed towards the middle region of human CDX2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Canine, Chicken/Avian, Porcine
- Host
- Rabbit
- Antigen sequence
QRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTD
HQRLE LEKEFHYSRY- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references p38 MAPK regulates cavitation and tight junction function in the mouse blastocyst.
Usefulness of Cdx2 in separating mucinous bronchioloalveolar adenocarcinoma of the lung from metastatic mucinous colorectal adenocarcinoma.
Bell CE, Watson AJ
PloS one 2013;8(4):e59528
PloS one 2013;8(4):e59528
Usefulness of Cdx2 in separating mucinous bronchioloalveolar adenocarcinoma of the lung from metastatic mucinous colorectal adenocarcinoma.
Saad RS, Cho P, Silverman JF, Liu Y
American journal of clinical pathology 2004 Sep;122(3):421-7
American journal of clinical pathology 2004 Sep;122(3):421-7
No comments: Submit comment
No validations: Submit validation data