HPA010964

NRG1 antibody from Atlas Antibodies
GGF, HGL, HRG, NDF, NRG1-IT2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA010964
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA010964, RRID:AB_1235019
Product name
Anti-NRG1
Provider product page
Atlas Antibodies - HPA010964
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KWFKNGNELNRKNKPQNIKIQKKPGKSELRINKAS
LADSGEYMCKVISKLGNDSASANITIVESNATSTS
TTGTSHLVKCAEKEKTFCVNGGECFMVKDLSNPSR
YLC
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -