HPA010964

NRG1 antibody from Atlas Antibodies
GGF, HGL, HRG, NDF, NRG1-IT2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA010964
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA010964, RRID:AB_1854641
Product name
Anti-NRG1
Provider product page
Atlas Antibodies - HPA010964
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KWFKNGNELNRKNKPQNIKIQKKPGKSELRINKAS
LADSGEYMCKVISKLGNDSASANITIVESNATSTS
TTGTSHLVKCAEKEKTFCVNGGECFMVKDLSNPSR
YLC
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -