HPA010964

NRG1 antibody from Sigma-Aldrich
GGF, HGL, HRG, NDF, NRG1-IT2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010964
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010964, RRID:AB_1854641
Product name
Anti-NRG1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010964
Antibody type
Polyclonal
Antigen
Pro-neuregulin-1, membrane-bound isoform precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KWFKNGNELNRKNKPQNIKIQKKPGKSELRINKAS
LADSGEYMCKVISKLGNDSASANITIVESNATSTS
TTGTSHLVKCAEKEKTFCVNGGECFMVKDLSNPSR
YLC
Storage
-20C
Provider Type Product Number
- No reagents -