AMAb90562

antibody from Atlas Antibodies

Targeting: EMD LEMD5, STA

Antibody data

Submit

Validation data

Product number: AMAb90562 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#AMAb90562, RRID:AB_2665587
Product name: Anti-EMD
Antibody type: Monoclonal
Reactivity: Human
Host: Mouse
Conjugate: Unconjugated
Antigen sequence: ASSYSFSDLNSTRGDADMYDLPKKEDALLYQSKGY NDDYYEESYFTTRTYGEPESAGPSRAVRQSVTSFP DADAFHHQVHDDDLLSSSEEECKDRERPMYGRDSA CQSITHY
Epitope: Binds to an epitope located within the peptide sequence QSKGYNDDYY as determined by overlapping synthetic peptides.
Isotype: IgG
Antibody clone number: CL0203
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

EMD protein structure - AMAb90562 shown in red.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunofluorescence staining in HeLa cell line with Anti-EMD monoclonal antibody, shows a distinct nuclear membranous pattern with a weaker additional ER staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunofluorescence staining in A431 cell line with Anti-EMD monoclonal antibody, shows a distinct nuclear membranous pattern with a weaker additional ER staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunofluorescence staining in MCF7 cell line with Anti-EMD monoclonal antibody, shows a distinct nuclear membranous pattern with a weaker additional ER staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunofluorescence staining in U2OS cell line with Anti-EMD monoclonal antibody, shows a distinct nuclear membranous pattern with a weaker additional ER staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunofluorescence staining in U251 cell line with Anti-EMD monoclonal antibody, shows a distinct nuclear membranous pattern with a weaker additional ER staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).
Sample type: HUMAN