Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA000609 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA000609, RRID:AB_1078736
- Product name
- Anti-EMD
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
ASSYSFSDLNSTRGDADMYDLPKKEDALLYQSKGY
NDDYYEESYFTTRTYGEPESAGPSRAVRQSVTSFP
DADAFHHQVHDDDLLSSSEEECKDRERPMYGRDSA
CQSITHY- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells.
Impact of genomic stability on protein expression in endometrioid endometrial cancer.
Stadler C, Rexhepaj E, Singan VR, Murphy RF, Pepperkok R, Uhlén M, Simpson JC, Lundberg E
Nature methods 2013 Apr;10(4):315-23
Nature methods 2013 Apr;10(4):315-23
Impact of genomic stability on protein expression in endometrioid endometrial cancer.
Lomnytska MI, Becker S, Gemoll T, Lundgren C, Habermann J, Olsson A, Bodin I, Engström U, Hellman U, Hellman K, Hellström AC, Andersson S, Mints M, Auer G
British journal of cancer 2012 Mar 27;106(7):1297-305
British journal of cancer 2012 Mar 27;106(7):1297-305
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in RT-4 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-EMD antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear membrane & endoplasmic reticulum.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows moderate nuclear membrane positivity in myocytes.
- Sample type
- HUMAN