Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb90560 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb90560, RRID:AB_2665586
- Product name
- Anti-EMD
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
ASSYSFSDLNSTRGDADMYDLPKKEDALLYQSKGY
NDDYYEESYFTTRTYGEPESAGPSRAVRQSVTSFP
DADAFHHQVHDDDLLSSSEEECKDRERPMYGRDSA
CQSITHY- Epitope
- Binds to an epitope located within the peptide sequence DALLYQSKGYNDDYY as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL0201
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in RT-4 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-EMD antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa]Lane 2: Human cell line RT-4
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of PC-3 cells using the Anti-EMD monoclonal antibody, showing specific staining in the nuclear membrane in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube shows strong positivity in the nuclear membrane of glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows strong immunoreactivity in the nuclear membrane in renal glomeruli and tubuli.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows strong immunoreactivity in the nuclear membrane in the trophoblast layer.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human stomach shows strong positivity in the nuclear membrane of glandular cells.