HPA000609

EMD antibody from Sigma-Aldrich
LEMD5, STA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000609
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000609, RRID:AB_1078736
Product name
Anti-EMD antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000609
Antibody type
Polyclonal
Antigen
Emerin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ASSYSFSDLNSTRGDADMYDLPKKEDALLYQSKGY
NDDYYEESYFTTRTYGEPESAGPSRAVRQSVTSFP
DADAFHHQVHDDDLLSSSEEECKDRERPMYGRDSA
CQSITHY
Storage
-20C
Provider Type Product Number
- No reagents -