HPA019154

SMAD4 antibody from Atlas Antibodies
DPC4, MADH4
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019154
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019154, RRID:AB_1853480
Product name
Anti-SMAD4
Provider product page
Atlas Antibodies - HPA019154
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AFDLKCDSVCVNPYHYERVVSPGIDLSGLTLQSNA
PSSMMVKDEYVHDFEGQPSLSTEGHSIQTIQHPPS
NRASTETYSTPALLAPSESNATSTANFPNIPVAST
SQPASILGGSHSEGLLQI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -