HPA024353

CD22 antibody from Sigma-Aldrich
SIGLEC-2, SIGLEC2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024353
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024353, RRID:AB_10600695
Product name
Anti-CD22 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024353
Antibody type
Polyclonal
Antigen
CD22 molecule recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVP
SEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLRM
ESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQE
VTLTCLLNFSCYGYPIQLQWLL
Storage
-20C
Provider Type Product Number
- No reagents -