HPA000233

GATA1 antibody from Atlas Antibodies
ERYF1, GATA-1, GF1, NF-E1, NFE1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000233
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000233, RRID:AB_1078951
Product name
Anti-GATA1
Provider product page
Atlas Antibodies - HPA000233
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PLTMRKDGIQTRNRKASGKGKKKRGSSLGGTGAAE
GPAGGFMVVAGGSGSGNCGEVASGLTLGPPGTAHL
YQGLGPVVLSGPVSHLMPFPGPLLGSPTGSFPTGP
MPPTTSTTVVAPL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -