HPA000232

GATA1 antibody from Sigma-Aldrich
ERYF1, GATA-1, GF1, NF-E1, NFE1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000232
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000232, RRID:AB_1078949
Product name
Anti-GATA1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000232
Antibody type
Polyclonal
Antigen
Erythroid transcription factor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EGLDAAASSTAPSTATAAAAALAYYRDAEAYRHSP
VFQVYPLLNCMEGIPGGSPYAGWAYGKTGLYPAST
VCPTREDSPPQAVEDLDGKGSTSFLETLKTERLSP
DLLTLGPALP
Storage
-20C
Provider Type Product Number
- No reagents -