Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN504054 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Peripherin (PRPH) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PRPH antibody: synthetic peptide directed towards the N terminal of human PRPH
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
RFANFIEKVRFLEQQNAALRGELSQARGQEPARAD
QLCQQ ELRELRRELE- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references An aggregate-inducing peripherin isoform generated through intron retention is upregulated in amyotrophic lateral sclerosis and associated with disease pathology.
Xiao S, Tjostheim S, Sanelli T, McLean JR, Horne P, Fan Y, Ravits J, Strong MJ, Robertson J
The Journal of neuroscience : the official journal of the Society for Neuroscience 2008 Feb 20;28(8):1833-40
The Journal of neuroscience : the official journal of the Society for Neuroscience 2008 Feb 20;28(8):1833-40
No comments: Submit comment
No validations: Submit validation data