Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184153 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Tumor Necrosis Factor (Ligand) Superfamily, Member 10 (TNFSF10) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TNFSF10 antibody: synthetic peptide directed towards the N terminal of human TNFSF10
- Description
- Affinity Purified
- Reactivity
- Human, Canine, Porcine
- Host
- Rabbit
- Antigen sequence
CFLKEDDSYWDPNDEESMNSPCWQVKWQLRQLVRK
MILRT SEETISTVQE- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references FoxO3a nuclear localization and its association with β-catenin and Smads in IFN-α-treated hepatocellular carcinoma cell lines.
Helicobacter pylori enhances tumor necrosis factor-related apoptosis-inducing ligand-mediated apoptosis in human gastric epithelial cells.
Ceballos MP, Parody JP, Quiroga AD, Casella ML, Francés DE, Larocca MC, Carnovale CE, Alvarez Mde L, Carrillo MC
Journal of interferon & cytokine research : the official journal of the International Society for Interferon and Cytokine Research 2014 Nov;34(11):858-69
Journal of interferon & cytokine research : the official journal of the International Society for Interferon and Cytokine Research 2014 Nov;34(11):858-69
Helicobacter pylori enhances tumor necrosis factor-related apoptosis-inducing ligand-mediated apoptosis in human gastric epithelial cells.
Wu YY, Tsai HF, Lin WC, Chou AH, Chen HT, Yang JC, Hsu PI, Hsu PN
World journal of gastroenterology : WJG 2004 Aug 15;10(16):2334-9
World journal of gastroenterology : WJG 2004 Aug 15;10(16):2334-9
No comments: Submit comment
No validations: Submit validation data