Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006102-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006102-M02, RRID:AB_566147
- Product name
- RP2 monoclonal antibody (M02), clone 5C10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RP2.
- Antigen sequence
RKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKA
PDFLPLLNKGPVIALEFNGDGAVEVCQLIVNEIFN
GTKMFVSESKETASGDVDSFYNFADIQMGI- Isotype
- IgG
- Antibody clone number
- 5C10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- RP2 monoclonal antibody (M02), clone 5C10 Western Blot analysis of RP2 expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of RP2 expression in transfected 293T cell line by RP2 monoclonal antibody (M02), clone 5C10.Lane 1: RP2 transfected lysate(39.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged RP2 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol