HPA001366

CDK16 antibody from Sigma-Aldrich
FLJ16665, PCTAIRE, PCTAIRE1, PCTGAIRE, PCTK1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001366
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001366, RRID:AB_1079584
Product name
Anti-PCTK1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001366
Antibody type
Polyclonal
Antigen
Serine/threonine-protein kinase PCTAIRE-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MDRMKKIKRQLSMTLRGGRGIDKTNGAPEQIGLDE
SGGGGGSDPGEAPTRAAPGELRSARGPLSSAPEIV
HEDLKMGSDGESDQASATSSDEVQSPVRVRMRNHP
PRKISTEDINKRLSLPAD
Storage
-20C
Provider Type Product Number
- No reagents -