Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009308-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009308-M01, RRID:AB_425803
- Product name
- CD83 monoclonal antibody (M01), clone 3G10-1F4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant CD83.
- Antigen sequence
MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPC
TAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRG
QHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTY
RCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKK
YRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDF
SKAGMERAFLPVTSPNKHLGLVTPHKTELV- Isotype
- IgG
- Antibody clone number
- 3G10-1F4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Zwitterionic polymer-coated immunobeads for blood-based cancer diagnostics.
Kim G, Yong Y, Kang HJ, Park K, Kim SI, Lee M, Huh N
Biomaterials 2014 Jan;35(1):294-303
Biomaterials 2014 Jan;35(1):294-303
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CD83 monoclonal antibody (M01), clone 3G10-1F4. Western Blot analysis of CD83 expression in human colon.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CD83 expression in transfected 293T cell line by CD83 monoclonal antibody (M01), clone 3G10-1F4.Lane 1: CD83 transfected lysate (Predicted MW: 23 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CD83 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of CD83 transfected lysate using anti-CD83 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with CD83 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol