Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005054-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005054-M01, RRID:AB_489751
- Product name
- SERPINE1 monoclonal antibody (M01), clone 3F2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SERPINE1.
- Antigen sequence
GFKIDDKGMAPALRHLYKELMGPWNKDEISTTDAI
FVQRDLKLVQGFMPHFFRLFRSTVKQVDFSEVERA
RFIINDWVKTHTKGMISNLLGKGAVDQLTR- Isotype
- IgG
- Antibody clone number
- 3F2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Extracellular matrix remodeling by bone marrow fibroblast-like cells correlates with disease progression in multiple myeloma.
Slany A, Haudek-Prinz V, Meshcheryakova A, Bileck A, Lamm W, Zielinski C, Gerner C, Drach J
Journal of proteome research 2014 Feb 7;13(2):844-54
Journal of proteome research 2014 Feb 7;13(2):844-54
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of SERPINE1 expression in transfected 293T cell line by SERPINE1 monoclonal antibody (M01), clone 3F2.Lane 1: SERPINE1 transfected lysate(45.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SERPINE1 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of SERPINE1 transfected lysate using anti-SERPINE1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with SERPINE1 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol