Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [3]
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- R31900 - Provider product page
- Provider
- NSJ Bioreagents
- Product name
- Tyrosine Hydroxylase Antibody / TH
- Antibody type
- Polyclonal
- Antigen
- Amino acids KVPWFPRKVSELDKCHHLVTKFDPDLDLDH of human TH were used as the immunogen for the Tyrosine Hydroxylase antibody.
- Description
- Antigen affinity
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Vial size
- 100 µg
- Concentration
- Lyophilized; resuspend with 200 ul for 0.5 mg/ml
- Storage
- After reconstitution, the Tyrosine Hydroxylase antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- NSJ Bioreagents (provider)
- Main image
- Experimental details
- Western blot testing of 1) rat brain and 2) mouse brain lysate with Tyrosine Hydroxylase antibody. Expected/observed molecular weight 55~60 kDa.
- Submitted by
- NSJ Bioreagents (provider)
- Main image
- Experimental details
- Western blot testing of 1) rat brain and 2) mouse brain lysate with Tyrosine Hydroxylase antibody. Expected molecular weight 55~60 kDa.
Supportive validation
- Submitted by
- NSJ Bioreagents (provider)
- Main image
- Experimental details
- Immunofluorescent staining of FFPE mouse brain tissue with Tyrosine Hydroxylase antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH8 EDTA buffer for 20 min.
- Submitted by
- NSJ Bioreagents (provider)
- Main image
- Experimental details
- Immunofluorescent staining of FFPE mouse brain tissue with Tyrosine Hydroxylase antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH8 EDTA buffer for 20 min.
- Submitted by
- NSJ Bioreagents (provider)
- Main image
- Experimental details
- Immunofluorescent staining of FFPE rat brain tissue with Tyrosine Hydroxylase antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH8 EDTA buffer for 20 min.
Supportive validation
- Submitted by
- NSJ Bioreagents (provider)
- Main image
- Experimental details
- IHC testing of FFPE mouse brain with Tyrosine Hydroxylase antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
- Submitted by
- NSJ Bioreagents (provider)
- Main image
- Experimental details
- IHC testing of FFPE rat brain with Tyrosine Hydroxylase antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
- Submitted by
- NSJ Bioreagents (provider)
- Main image
- Experimental details
- IHC testing of FFPE mouse brain with Tyrosine Hydroxylase antibody. HIER: Boil the paraffin sections in pH8 EDTA buffer for 20 minutes and allow to cool prior to staining.
- Submitted by
- NSJ Bioreagents (provider)
- Main image
- Experimental details
- IHC testing of FFPE rat brain with Tyrosine Hydroxylase antibody. HIER: Boil the paraffin sections in pH8 EDTA buffer for 20 minutes and allow to cool prior to staining.
