HPA000504

HTATSF1 antibody from Atlas Antibodies
TAT-SF1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000504
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000504, RRID:AB_10752094
Product name
Anti-HTATSF1
Provider product page
Atlas Antibodies - HPA000504
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GKDGDTQTDAGGEPDSLGQQPTDTPYEWDLDKKAW
FPKITEDFIATYQANYGFSNDGASSSTANVEDVHA
RTAEEPPQEKAPEPTDARKKGEKRKAESGWFHVEE
DRNTNVYVSGLPPDITVDE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -