Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006361-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006361-M02, RRID:AB_10642593
- Product name
- CCL17 monoclonal antibody (M02), clone 1F11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CCL17.
- Antigen sequence
ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCS
RDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLER
S- Isotype
- IgG
- Antibody clone number
- 1F11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to CCL17 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol