H00001026-M02
antibody from Abnova Corporation
Targeting: CDKN1A
CAP20, CDKN1, CIP1, P21, p21CIP1, p21Cip1/Waf1, SDI1, WAF1
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001026-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001026-M02, RRID:AB_463798
- Product name
- CDKN1A monoclonal antibody (M02), clone 2F1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CDKN1A.
- Antigen sequence
WERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSP
ALLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGP
GDSQGRKRRQTSMTDFYHSKRRLIFSKRKP- Isotype
- IgG
- Antibody clone number
- 2F1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Phospho-ΔNp63α is a key regulator of the cisplatin-induced microRNAome in cancer cells.
Huang Y, Chuang A, Hao H, Talbot C, Sen T, Trink B, Sidransky D, Ratovitski E
Cell death and differentiation 2011 Jul;18(7):1220-30
Cell death and differentiation 2011 Jul;18(7):1220-30
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CDKN1A monoclonal antibody (M02), clone 2F1. Western Blot analysis of CDKN1A expression in human liver.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CDKN1A is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to CDKN1A on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between CASP3 and CDKN1A. HeLa cells were stained with anti-CASP3 rabbit purified polyclonal 1:1200 and anti-CDKN1A mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)