HPA000911

FGD1 antibody from Sigma-Aldrich
FGDY, ZFYVE3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000911
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000911, RRID:AB_1078853
Product name
Anti-FGD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000911
Antibody type
Polyclonal
Antigen
FYVE, RhoGEF and PH domain-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DSDPGASEPGLLARRGSGSALGGPLDPQFVGPSDT
SLGAAPGHRVLPCGPSPQHHRALRFSYHLEGSQPR
PGLHQGNRILVKSLSLDPGQSLEPHPEGPQRLRSD
P
Storage
-20C
Provider Type Product Number
- No reagents -