HPA019492

RFFL antibody from Atlas Antibodies
CARP-2, CARP2, fring, rififylin, RNF189, RNF34L
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019492
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019492, RRID:AB_1856190
Product name
Anti-RFFL
Provider product page
Atlas Antibodies - HPA019492
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MKVKDLRDYLSLHDISTEMCREKEELVLLVLGQQP
VISQEDRTRASTLSPDFPEQQAFLTQPHSSMVPPT
SPNLPSSS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -