ABIN971556
antibody from antibodies-online
Targeting: RFFL
CARP-2, CARP2, fring, rififylin, RNF189, RNF34L
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN971556 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Ring Finger and FYVE-Like Domain Containing 1 (RFFL) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-RFFL antibody: synthetic peptide directed towards the middle region of human RFFL
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
KDQKGLQHLVSGAEDQNGGAVPSGLEENLCKICMD
SPIDC VLLECGHMVT- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Identification of the flagellin glycosylation system in Burkholderia cenocepacia and the contribution of glycosylated flagellin to evasion of human innate immune responses.
Hanuszkiewicz A, Pittock P, Humphries F, Moll H, Rosales AR, Molinaro A, Moynagh PN, Lajoie GA, Valvano MA
The Journal of biological chemistry 2014 Jul 4;289(27):19231-44
The Journal of biological chemistry 2014 Jul 4;289(27):19231-44
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting