HPA019492

RFFL antibody from Sigma-Aldrich
fring, rififylin, RNF189, RNF34L
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019492
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019492, RRID:AB_1856190
Product name
Anti-RFFL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019492
Antibody type
Polyclonal
Antigen
E3 ubiquitin-protein ligase rififylin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MKVKDLRDYLSLHDISTEMCREKEELVLLVLGQQP
VISQEDRTRASTLSPDFPEQQAFLTQPHSSMVPPT
SPNLPSSS
Storage
-20C
Provider Type Product Number
- No reagents -